PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C019337P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family G2-like
Protein Properties Length: 451aa    MW: 49283.3 Da    PI: 6.104
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C019337P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like89.23.6e-28171225156
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                     k +++WtpeLH+rFv+aveqL G +kA+P++ilelm++++Lt+++v+SHLQkYR++
  MELO3C019337P1 171 KVKVDWTPELHRRFVQAVEQL-GVDKAVPSRILELMGIECLTRHNVASHLQKYRSH 225
                     5689*****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.242168227IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.9E-27169228IPR009057Homeodomain-like
SuperFamilySSF466893.23E-18169228IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-26171225IPR006447Myb domain, plants
PfamPF002494.9E-8174223IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007165Biological Processsignal transduction
GO:0009658Biological Processchloroplast organization
GO:0009910Biological Processnegative regulation of flower development
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0010638Biological Processpositive regulation of organelle organization
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 451 aa     Download sequence    Send to blast
MLALSPIRSG NKDEKQGEME RFSIGGDDFP DFDDDTNLLD SINFDDLFVG INDGDVLPDL  60
EMDPELLAEF SVSGGEESEV NASVSLEKFD DNTLKIIGNK DNDDDEDQKD LDSRSSSQVV  120
DQEILSKRDD ELATPTNIIE ANPLVKDSGD KSIKPQKASS SQSKNSQGKR KVKVDWTPEL  180
HRRFVQAVEQ LGVDKAVPSR ILELMGIECL TRHNVASHLQ KYRSHRKHLL AREAEAASWS  240
QRRQMYGGGG GGGGKREVSS WGAPPTMGFP PMTPMHPHFR PLHVWGHPPA MDQSLLHVWP  300
KHLPHSPSPP PPPPTPPPSS WPHAAAPPPP PDPSYWHHHH QRVPNGLTSG TPCFPQPIPT  360
TRFGGASFSV IPPPHPMYKA AEPTTSVGRS PTHPPLDSYP SKESIDSAIG DVLAKPWLPL  420
PLGLKPPSLD SVKVELQRQG IPKIPPTCAA *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-15168223257ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00022PBMTransfer from AT2G20570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819160.0LN681916.1 Cucumis melo genomic scaffold, anchoredscaffold00037.
GenBankLN7132650.0LN713265.1 Cucumis melo genomic chromosome, chr_11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008455954.10.0PREDICTED: transcription activator GLK1-like
TrEMBLA0A0A0LQW90.0A0A0A0LQW9_CUCSA; Uncharacterized protein
STRINGVIT_12s0028g03100.t011e-168(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42423461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.18e-57GBF's pro-rich region-interacting factor 1